SGSH (NM_000199) Human Recombinant Protein
CAT#: TP308270
Recombinant protein of human N-sulfoglucosamine sulfohydrolase (SGSH), 20 µg
View other "SGSH" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC208270 protein sequence 
Red=Cloning site Green=Tags(s) MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSC SPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTE ENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDW TPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPS GRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLP ALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQP TGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEK LSPQCQPLHNEL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 54.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_000190 | 
| Locus ID | 6448 | 
| UniProt ID | P51688 | 
| Refseq Size | 2770 | 
| Cytogenetics | 17q25.3 | 
| Refseq ORF | 1506 | 
| Synonyms | HSS; MPS3A; SFMD | 
| Summary | This gene encodes the enzyme sulfamidase; one of several enzymes involved in the lysosomal degradation of heparan sulfate. Mutations in this gene are associated with the lysosomal storage disease mucopolysaccaridosis IIIA, also known as Sanfilippo syndrome A, which results from impaired degradation of heparan sulfate. Transcripts of varying sizes have been reported but their biological validity has not been determined. [provided by RefSeq, Jun 2017] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC424866 | SGSH HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY424866 | Transient overexpression lysate of N-sulfoglucosamine sulfohydrolase (SGSH) | 
                                                     CNY 3080.00  | 
                                            |
| PH308270 | SGSH MS Standard C13 and N15-labeled recombinant protein (NP_000190) | 
                                                     CNY 19520.00  | 
                                            |
| TP720741 | Purified recombinant protein of Human N-sulfoglucosamine sulfohydrolase (SGSH) | 
                                                     CNY 1800.00  | 
                                            
