INO80E (NM_173618) Human Recombinant Protein
CAT#: TP308292
Recombinant protein of human INO80 complex subunit E (INO80E), 20 µg
View other "INO80E" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208292 protein sequence
Red=Cloning site Green=Tags(s) MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDS DATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPP FPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPP PTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_775889 |
| Locus ID | 283899 |
| UniProt ID | Q8NBZ0 |
| Refseq Size | 1185 |
| Cytogenetics | 16p11.2 |
| Refseq ORF | 732 |
| Synonyms | CCDC95 |
| Summary | Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406508 | INO80E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406508 | Transient overexpression lysate of INO80 complex subunit E (INO80E) |
CNY 3080.00 |
|
| PH308292 | INO80E MS Standard C13 and N15-labeled recombinant protein (NP_775889) |
CNY 19520.00 |
