Axin 1 (AXIN1) (NM_181050) Human Recombinant Protein
CAT#: TP308349
Recombinant protein of human axin 1 (AXIN1), transcript variant 2, 20 µg
View other "Axin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208349 representing NM_181050
Red=Cloning site Green=Tags(s) MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGY EPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKL ARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEY TRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRV SSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRK QHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPG HRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQS SFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQ KIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPA PNPLTQLEEARRRLEEEEKRASRAPSKQRTRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVT LGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 91.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Pull-down assay (PMID: 27294323) |
Reference Data | |
RefSeq | NP_851393 |
Locus ID | 8312 |
UniProt ID | O15169 |
Refseq Size | 3369 |
Cytogenetics | 16p13.3 |
Refseq ORF | 2478 |
Synonyms | AXIN; PPP1R49 |
Summary | This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Pathways in cancer, Wnt signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Small-molecule binding of the axin RGS domain promotes ß-catenin and Ras degradation
,Cha, PH;Cho, YH;Lee, SK;Lee, J;Jeong, WJ;Moon, BS;Yun, JH;Yang, JS;Choi, S;Yoon, J;Kim, HY;Kim, MY;Kaduwal, S;Lee, W;Min, DS;Kim, H;Han, G;Choi, KY;,
Nat. Chem. Biol.
,PubMed ID 27294323
[AXIN1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405798 | AXIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418638 | AXIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY405798 | Transient overexpression lysate of axin 1 (AXIN1), transcript variant 2 |
CNY 3080.00 |
|
LY418638 | Transient overexpression lysate of axin 1 (AXIN1), transcript variant 1 |
CNY 4840.00 |
|
PH308349 | AXIN1 MS Standard C13 and N15-labeled recombinant protein (NP_851393) |
CNY 19520.00 |