QPCT (NM_012413) Human Recombinant Protein
CAT#: TP308388
Recombinant protein of human glutaminyl-peptide cyclotransferase (QPCT), 20 µg
View other "QPCT" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208388 protein sequence
Red=Cloning site Green=Tags(s) MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDL QPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACH YDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQ DSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHE LGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI LQVFVLEYLHL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036545 |
| Locus ID | 25797 |
| UniProt ID | Q16769 |
| Refseq Size | 1719 |
| Cytogenetics | 2p22.2 |
| Refseq ORF | 1083 |
| Synonyms | GCT; QC; sQC |
| Summary | This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008] |
| Protein Families | Protease |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Soluble Variants of Human Recombinant Glutaminyl Cyclase
,null,
PLoS ONE
,PubMed ID 23977104
[QPCT]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415772 | QPCT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415772 | Transient overexpression lysate of glutaminyl-peptide cyclotransferase (QPCT) |
CNY 3080.00 |
|
| PH308388 | QPCT MS Standard C13 and N15-labeled recombinant protein (NP_036545) |
CNY 19520.00 |
