HHAT (NM_018194) Human Recombinant Protein
CAT#: TP308447
Recombinant protein of human hedgehog acyltransferase (HHAT), transcript variant 1, 20 µg
View other "HHAT" proteins (1)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208447 representing NM_018194
Red=Cloning site Green=Tags(s) MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQW LVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCS LLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFY YPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGWAAFFAGGGWPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060664 |
| Locus ID | 55733 |
| UniProt ID | Q5VTY9 |
| Refseq Size | 3598 |
| Cytogenetics | 1q32.2 |
| Refseq ORF | 777 |
| Synonyms | MART2; SKI1; Skn |
| Summary | 'Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).[supplied by OMIM, Jul 2002] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| PH308447 | HHAT MS Standard C13 and N15-labeled recombinant protein (NP_060664) |
CNY 19520.00 |
