PLAC1L (OOSP2) (NM_173801) Human Recombinant Protein
CAT#: TP308472
Recombinant protein of human placenta-specific 1-like (PLAC1L), 20 µg
View other "PLAC1L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208472 protein sequence
Red=Cloning site Green=Tags(s) MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD FQTTAEELGLLSSSPNLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_776162 |
| Locus ID | 219990 |
| UniProt ID | Q86WS3 |
| Refseq Size | 1646 |
| Cytogenetics | 11q12.1 |
| Refseq ORF | 474 |
| Synonyms | OOSP2A; PLAC1L; TMEM122 |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403561 | OOSP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403561 | Transient overexpression lysate of placenta-specific 1-like (PLAC1L) |
CNY 3080.00 |
|
| PH308472 | PLAC1L MS Standard C13 and N15-labeled recombinant protein (NP_776162) |
CNY 19520.00 |
