ADSS1 (NM_152328) Human Recombinant Protein
CAT#: TP308536
Recombinant protein of human adenylosuccinate synthase like 1 (ADSSL1), transcript variant 2, 20 µg
View other "ADSS1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208536 protein sequence
Red=Cloning site Green=Tags(s) MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIISRCQGGNNAG HTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGLKDWEKRLIISDRAHLVFDF HQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFSSRFKNLAHQHQSMFPTL EIDIEGQLKRLKGFAERIRPMVRDGVYFMYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGV CTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYA HMVNGFTALALTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689541 |
Locus ID | 122622 |
UniProt ID | Q8N142 |
Refseq Size | 1769 |
Cytogenetics | 14q32.33 |
Refseq ORF | 1371 |
Synonyms | ADSSL1; MPD5 |
Summary | This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404666 | ADSSL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC407633 | ADSSL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404666 | Transient overexpression lysate of adenylosuccinate synthase like 1 (ADSSL1), transcript variant 1 |
CNY 4840.00 |
|
LY407633 | Transient overexpression lysate of adenylosuccinate synthase like 1 (ADSSL1), transcript variant 2 |
CNY 3080.00 |
|
PH308536 | ADSSL1 MS Standard C13 and N15-labeled recombinant protein (NP_689541) |
CNY 19520.00 |