CPA4 (NM_016352) Human Recombinant Protein

CAT#: TP308575M

Recombinant protein of human carboxypeptidase A4 (CPA4), 100 µg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 9998.00


货期*
4周

规格
    • 100 ug

Product images

推荐一起购买 (2)
CPA4 Antibody - middle region
    • 100 ul

CNY 5250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC208575 protein sequence
Red=Cloning site Green=Tags(s)

MRWILFIGALIGSSICGQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPS
VSLQAFKSFLRSQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADF
PDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITS
ILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP
HANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEY
QVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Y

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 45.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057436
Locus ID 51200
UniProt ID Q9UI42
Refseq Size 2817
Cytogenetics 7q32.2
Refseq ORF 1263
Synonyms CPA3
Summary This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protease, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...