VASH2 (NM_024749) Human Recombinant Protein
CAT#: TP308692
Recombinant protein of human vasohibin 2 (VASH2), transcript variant 1, 20 µg
View other "VASH2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208692 protein sequence
Red=Cloning site Green=Tags(s) MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHV AKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLHYLTNGQPSIERFPISFKT YFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPH EPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPR RLGRREKSPALPEKKVADLSTLNEVGYQIRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA standard (PMID: 27702660) |
| Reference Data | |
| RefSeq | NP_079025 |
| Locus ID | 79805 |
| UniProt ID | Q86V25 |
| Refseq Size | 4362 |
| Cytogenetics | 1q32.3 |
| Refseq ORF | 933 |
| Summary | Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869). Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis (PubMed:19204325).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Vasohibin 2 promotes human luminal breast cancer angiogenesis in a non-paracrine manner via transcriptional activation of fibroblast growth factor 2
,Tu, M;Lu, C;Lv, N;Wei, J;Lu, Z;Xi, C;Chen, J;Guo, F;Jiang, K;Li, Q;Wu, J;Song, G;Wang, S;Gao, W;Miao, Y;,
Cancer Lett.
,PubMed ID 27702660
[VASH2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411100 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427885 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427886 | VASH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411100 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 1 |
CNY 3080.00 |
|
| LY427885 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 2 |
CNY 3080.00 |
|
| LY427886 | Transient overexpression lysate of vasohibin 2 (VASH2), transcript variant 3 |
CNY 3080.00 |
|
| PH308692 | VASH2 MS Standard C13 and N15-labeled recombinant protein (NP_079025) |
CNY 19520.00 |
