WDR58 (THOC6) (NM_024339) Human Recombinant Protein
CAT#: TP308694
Recombinant protein of human THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1, 20 µg
View other "WDR58" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208694 protein sequence
Red=Cloning site Green=Tags(s) MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVV TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYK HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCV NQWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_077315 |
| Locus ID | 79228 |
| UniProt ID | Q86W42 |
| Refseq Size | 1444 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 1023 |
| Synonyms | fSAP35; WDR58 |
| Summary | This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome. [provided by RefSeq, Dec 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411297 | THOC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428050 | THOC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411297 | Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1 |
CNY 3080.00 |
|
| LY428050 | Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 2 |
CNY 3080.00 |
|
| PH308694 | THOC6 MS Standard C13 and N15-labeled recombinant protein (NP_077315) |
CNY 19520.00 |
