SGPL1 (NM_003901) Human Recombinant Protein
CAT#: TP308705
Recombinant protein of human sphingosine-1-phosphate lyase 1 (SGPL1), 20 µg
View other "SGPL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208705 representing NM_003901
Red=Cloning site Green=Tags(s) MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRF KKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFW QEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGG TESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNT AMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISAD THKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLL HARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQ MNGSPKPH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003892 |
| Locus ID | 8879 |
| UniProt ID | O95470 |
| Refseq Size | 4701 |
| Cytogenetics | 10q22.1 |
| Refseq ORF | 1704 |
| Synonyms | NPHS14; S1PL; SPL |
| Summary | Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis (PubMed:11018465, PubMed:14570870, PubMed:24809814, PubMed:28165339). Required for global lipid homeostasis in liver and cholesterol homeostasis in fibroblasts. Involved in the regulation of pro-inflammatory response and neutrophil trafficking. Modulates neuronal autophagy via phosphoethanolamine production which regulates accumulation of aggregate-prone proteins such as APP (By similarity). Seems to play a role in establishing neuronal contact sites and axonal maintenance (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Site-Dependent Cysteine Lipidation Potentiates the Activation of Proapoptotic BAX
,Cohen, DT;Wales, TE;McHenry, MW;Engen, JR;Walensky, LD;,
Cell Rep
,PubMed ID 32160532
[SGPL1]
|
|
First evidence of SGPL1 expression in the cell membrane silencing the extracellular S1P siren in mammary epithelial cells
,null,
PLoS ONE
,PubMed ID 29718989
[SGPL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418357 | SGPL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418357 | Transient overexpression lysate of sphingosine-1-phosphate lyase 1 (SGPL1) |
CNY 3080.00 |
|
| PH308705 | SGPL1 MS Standard C13 and N15-labeled recombinant protein (NP_003892) |
CNY 19520.00 |


