Calcium independent Phospholipase A2 (PLA2G6) (NM_001004426) Human Recombinant Protein
CAT#: TP308735
Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2, 20 µg
View other "Calcium independent Phospholipase A2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208735 protein sequence
Red=Cloning site Green=Tags(s) MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRM KDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFN QNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKV KKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVG IQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 83.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001004426 |
| Locus ID | 8398 |
| UniProt ID | O60733 |
| Refseq Size | 3077 |
| Cytogenetics | 22q13.1 |
| Refseq ORF | 2256 |
| Synonyms | CaI-PLA2; GVI; INAD1; iPLA2; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; PARK14; PLA2; PNPLA9 |
| Summary | The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010] |
| Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400377 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418601 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400377 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2 |
CNY 3080.00 |
|
| LY418601 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
CNY 3080.00 |
|
| PH307546 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_003551) |
CNY 19520.00 |
|
| PH308735 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_001004426) |
CNY 19520.00 |
|
| TP307546 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Calcium independent Phospholipase A2产品
