LAP2 (TMPO) (NM_001032283) Human Recombinant Protein
CAT#: TP308781
Recombinant protein of human thymopoietin (TMPO), transcript variant 2, 20 µg
View other "LAP2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208781 protein sequence
Red=Cloning site Green=Tags(s) MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001027454 |
| Locus ID | 7112 |
| UniProt ID | P42167 |
| Refseq Size | 4186 |
| Cytogenetics | 12q23.1 |
| Refseq ORF | 1362 |
| Synonyms | CMD1T; LAP2; LEMD4; PRO0868; TP |
| Summary | Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019] |
| Protein Families | Stem cell - Pluripotency, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418798 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422295 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422296 | TMPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418798 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 |
CNY 4840.00 |
|
| LY422295 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 |
CNY 3080.00 |
|
| LY422296 | Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 |
CNY 3080.00 |
|
| PH308781 | TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454) |
CNY 19520.00 |
|
| TP720158 | Recombinant protein of human thymopoietin (TMPO), transcript variant 2 |
CNY 1800.00 |
|
| TP761176 | Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
