CSP (DNAJC5) (NM_025219) Human Recombinant Protein
CAT#: TP308826
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208826 representing NM_025219
Red=Cloning site Green=Tags(s) MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079495 |
| Locus ID | 80331 |
| UniProt ID | Q9H3Z4 |
| Refseq Size | 3286 |
| Cytogenetics | 20q13.33 |
| Refseq ORF | 594 |
| Synonyms | CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL |
| Summary | This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. [provided by RefSeq, Nov 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410833 | DNAJC5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410833 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) |
CNY 3080.00 |
|
| PH308826 | DNAJC5 MS Standard C13 and N15-labeled recombinant protein (NP_079495) |
CNY 19520.00 |
