Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein
CAT#: TP308888L
Recombinant protein of human apolipoprotein C-I (APOC1), 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (3)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC208888 protein sequence 
Red=Cloning site Green=Tags(s) MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE TFQKVKEKLKIDS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 6.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001636 | 
| Locus ID | 341 | 
| UniProt ID | P02654 | 
| Refseq Size | 464 | 
| Cytogenetics | 19q13.32 | 
| Refseq ORF | 249 | 
| Synonyms | Apo-CI; apo-CIB; ApoC-I; apoC-IB | 
| Summary | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016] | 
| Protein Families | Secreted Protein | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    其它Apolipoprotein CI产品
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        