SOX9 (NM_000346) Human Recombinant Protein
CAT#: TP308944
Recombinant protein of human SRY (sex determining region Y)-box 9 (SOX9), 20 µg
View other "SOX9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208944 representing NM_000346
Red=Cloning site Green=Tags(s) MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFP VCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLG KLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQAD SPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSS DVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP QTHSPQHWEQPVYTQLTRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | EMSA assay (PMID: 26040697) |
| Reference Data | |
| RefSeq | NP_000337 |
| Locus ID | 6662 |
| UniProt ID | P48436 |
| Refseq Size | 3935 |
| Cytogenetics | 17q24.3 |
| Refseq ORF | 1527 |
| Synonyms | CMD1; CMPD1; SRA1; SRXX2; SRXY10 |
| Summary | The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq, Jul 2008] |
| Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Context-specific role of SOX9 in NF-Y mediated gene regulation in colorectal cancer cells
,Shi, Z;Chiang, CI;Labhart, P;Zhao, Y;Yang, J;Mistretta, TA;Henning, SJ;Maity, SN;Mori-Akiyama, Y;,
Nucleic Acids Res.
,PubMed ID 26040697
[SOX9]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424779 | SOX9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424779 | Transient overexpression lysate of SRY (sex determining region Y)-box 9 (SOX9) |
CNY 3080.00 |
|
| PH308944 | SOX9 MS Standard C13 and N15-labeled recombinant protein (NP_000337) |
CNY 19520.00 |


