SKAR (POLDIP3) (NM_178136) Human Recombinant Protein
CAT#: TP308957
Purified recombinant protein of Human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 2, 20 µg
View other "SKAR" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208957 representing NM_178136
Red=Cloning site Green=Tags(s) MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT PALKLTKTIQNLYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAP ALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELFCVCGALKRA RLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKESELPR RVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIKL myc-FLAG tag |
| Tag | Myc-DDK |
| Predicted MW | 42.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate Bradford method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_835237 |
| Locus ID | 84271 |
| UniProt ID | Q9BY77, Q9BY77-2 |
| Refseq Size | 3348 |
| Cytogenetics | 22q13.2 |
| Refseq ORF | 1176 |
| Synonyms | PDIP3; PDIP46; SKAR |
| Summary | This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410211 | POLDIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410211 | Transient overexpression lysate of polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1 |
CNY 3080.00 |
|
| PH310583 | POLDIP3 MS Standard C13 and N15-labeled recombinant protein (NP_115687) |
CNY 14250.00 |
|
| TP310583 | Recombinant protein of human polymerase (DNA-directed), delta interacting protein 3 (POLDIP3), transcript variant 1, 20 µg |
CNY 2900.00 |
