Josephin 2 (JOSD2) (NM_138334) Human Recombinant Protein
CAT#: TP309025
Recombinant protein of human Josephin domain containing 2 (JOSD2), 20 µg
View other "Josephin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209025 protein sequence
Red=Cloning site Green=Tags(s) MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDV NVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLD SKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612207 |
Locus ID | 126119 |
UniProt ID | Q8TAC2 |
Refseq Size | 863 |
Cytogenetics | 19q13.33 |
Refseq ORF | 564 |
Synonyms | SBBI54 |
Summary | This gene encodes a protein containing a Josephin domain. Josephin domain-containing proteins are deubiquitinating enzymes which catalyze the hydrolysis of the bond between the C-terminal glycine of the ubiquitin peptide and protein substrates. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408621 | JOSD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408621 | Transient overexpression lysate of Josephin domain containing 2 (JOSD2) |
CNY 3080.00 |
|
PH309025 | JOSD2 MS Standard C13 and N15-labeled recombinant protein (NP_612207) |
CNY 19520.00 |
其它Josephin 2产品