FENS1 (WDFY1) (NM_020830) Human Recombinant Protein
CAT#: TP309030
Recombinant protein of human WD repeat and FYVE domain containing 1 (WDFY1), 20 µg
View other "FENS1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209030 protein sequence
Red=Cloning site Green=Tags(s) MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYWPSIYHTMASP CSAMAYHHDSRRIFVGQDNGAVMEFHVSEDFNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGHDKCVSW MCTRSGNMLGRHFFTSWASCLQYDFDTQYAFVGDYSGQITLLKLEQNTCSVITTLKGHEGSVACLWWDPI QRLLFSGASDNSIIMWDIGGRKGRTLLLQGHHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQ WLESDSCQKCEQPFFWNIKQMWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDS IKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVGCSLATGFSPH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065881 |
Locus ID | 57590 |
UniProt ID | Q8IWB7 |
Refseq Size | 4607 |
Cytogenetics | 2q36.1 |
Refseq ORF | 1230 |
Synonyms | FENS-1; FENS1; WDF1; ZFYVE17 |
Summary | The protein encoded by this gene is a phosphatidylinositol 3-phosphate binding protein, which contains a FYVE zinc finger domain and multiple WD-40 repeat domains. When exogenously expressed, it localizes to early endosomes. Mutagenesis analysis demonstrates that this endosomal localization is mediated by the FYVE domain. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402807 | WDFY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402807 | Transient overexpression lysate of WD repeat and FYVE domain containing 1 (WDFY1) |
CNY 3080.00 |
|
PH309030 | WDFY1 MS Standard C13 and N15-labeled recombinant protein (NP_065881) |
CNY 19520.00 |