Chymotrypsin like protease (CTRL) (NM_001907) Human Recombinant Protein
CAT#: TP309072
Recombinant protein of human chymotrypsin-like (CTRL), 20 µg
View other "Chymotrypsin like protease" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209072 protein sequence
Red=Cloning site Green=Tags(s) MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001898 |
Locus ID | 1506 |
UniProt ID | P40313, A0A024R6Z5 |
Refseq Size | 1197 |
Cytogenetics | 16q22.1 |
Refseq ORF | 792 |
Synonyms | CTRL1 |
Summary | This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419665 | CTRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419665 | Transient overexpression lysate of chymotrypsin-like (CTRL) |
CNY 3,080.00 |
|
PH309072 | CTRL MS Standard C13 and N15-labeled recombinant protein (NP_001898) |
CNY 19,520.00 |
|
TP720385 | Recombinant protein of human chymotrypsin-like (CTRL) |
CNY 4,550.00 |
其它Chymotrypsin like protease产品