Phosphoserine phosphatase (PSPH) (NM_004577) Human Recombinant Protein
CAT#: TP309090
Recombinant protein of human phosphoserine phosphatase (PSPH), 20 µg
View other "Phosphoserine phosphatase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209090 protein sequence
Red=Cloning site Green=Tags(s) MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK WYITDFVELLGELEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004568 |
| Locus ID | 5723 |
| UniProt ID | P78330 |
| Refseq Size | 2142 |
| Cytogenetics | 7p11.2 |
| Refseq ORF | 675 |
| Synonyms | PSP; PSPHD |
| Summary | The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417896 | PSPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417896 | Transient overexpression lysate of phosphoserine phosphatase (PSPH) |
CNY 3080.00 |
|
| PH309090 | PSPH MS Standard C13 and N15-labeled recombinant protein (NP_004568) |
CNY 14250.00 |
|
| TP720145 | Recombinant protein of human phosphoserine phosphatase (PSPH) |
CNY 1800.00 |
其它Phosphoserine phosphatase产品
