GPT2 (NM_133443) Human Recombinant Protein
CAT#: TP309119
Recombinant protein of human glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1, 20 µg
View other "GPT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209119 protein sequence
Red=Cloning site Green=Tags(s) MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAVEYAVRGPIVL KAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQ ACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVM IPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRK CIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYR GGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGT YHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 57.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_597700 |
Locus ID | 84706 |
UniProt ID | Q8TD30 |
Refseq Size | 3963 |
Cytogenetics | 16q11.2 |
Refseq ORF | 1569 |
Synonyms | ALT2; GPT 2; MRT49; NEDSPM |
Summary | This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity
,Hu, Z;Lausted, C;Yoo, H;Yan, X;Brightman, A;Chen, J;Wang, W;Bu, X;Hood, L;,
Theranostics, Jan 2014.
,PubMed ID 24465277
[GPT2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408784 | GPT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408784 | Transient overexpression lysate of glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2), transcript variant 1 |
CNY 3080.00 |
|
PH309119 | GPT2 MS Standard C13 and N15-labeled recombinant protein (NP_597700) |
CNY 19520.00 |