SSPN (NM_005086) Human Recombinant Protein
CAT#: TP309123
Recombinant protein of human sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1, 20 µg
View other "SSPN" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209123 protein sequence
Red=Cloning site Green=Tags(s) MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005077 |
| Locus ID | 8082 |
| UniProt ID | Q14714 |
| Refseq Size | 4547 |
| Cytogenetics | 12p12.1 |
| Refseq ORF | 729 |
| Synonyms | DAGA5; KRAG; NSPN; SPN1; SPN2 |
| Summary | This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417535 | SSPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417535 | Transient overexpression lysate of sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 1 |
CNY 3080.00 |
|
| PH309123 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_005077) |
CNY 19520.00 |
|
| PH327888 | SSPN MS Standard C13 and N15-labeled recombinant protein (NP_001129295) |
CNY 14250.00 |
|
| TP327888 | Purified recombinant protein of Homo sapiens sarcospan (Kras oncogene-associated gene) (SSPN), transcript variant 2, 20 µg |
CNY 2900.00 |
