MORN3 (NM_173855) Human Recombinant Protein
CAT#: TP309166
Recombinant protein of human MORN repeat containing 3 (MORN3), 20 µg
View other "MORN3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209166 protein sequence
Red=Cloning site Green=Tags(s) MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGK RDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQ WENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPT QFPIPEVKILDPDGVLAEALAMFRKTEEGD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_776254 |
| Locus ID | 283385 |
| UniProt ID | Q6PF18 |
| Refseq Size | 1172 |
| Cytogenetics | 12q24.31 |
| Refseq ORF | 720 |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406324 | MORN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406324 | Transient overexpression lysate of MORN repeat containing 3 (MORN3) |
CNY 3080.00 |
|
| PH309166 | MORN3 MS Standard C13 and N15-labeled recombinant protein (NP_776254) |
CNY 19520.00 |

