Factor D (CFD) (NM_001928) Human Recombinant Protein
CAT#: TP309272L
Purified recombinant protein of Homo sapiens complement factor D (adipsin) (CFD), 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (2)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC209272 protein sequence 
Red=Cloning site Green=Tags(s) MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLED AADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDR DVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGG PLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 24.9 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001919 | 
| Locus ID | 1675 | 
| UniProt ID | P00746 | 
| Refseq Size | 1173 | 
| Cytogenetics | 19p13.3 | 
| Refseq ORF | 759 | 
| Synonyms | ADIPSIN; ADN; DF; PFD | 
| Summary | This gene encodes a member of the S1, or chymotrypsin, family of serine peptidases. This protease catalyzes the cleavage of factor B, the rate-limiting step of the alternative pathway of complement activation. This protein also functions as an adipokine, a cell signaling protein secreted by adipocytes, which regulates insulin secretion in mice. Mutations in this gene underlie complement factor D deficiency, which is associated with recurrent bacterial meningitis infections in human patients. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature protease. [provided by RefSeq, Nov 2015] | 
| Protein Families | Druggable Genome, Protease, Secreted Protein | 
| Protein Pathways | Complement and coagulation cascades | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    其它Factor D产品
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        