CAVIN1 (NM_012232) Human Recombinant Protein
CAT#: TP309277
Recombinant protein of human polymerase I and transcript release factor (PTRF), 20 µg
View other "CAVIN1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209277 representing NM_012232
Red=Cloning site Green=Tags(s) MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQL TQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEV NEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVE EVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTR LVPAERREKLKTSXDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDE GGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036364 |
| Locus ID | 284119 |
| UniProt ID | Q6NZI2 |
| Refseq Size | 3580 |
| Cytogenetics | 17q21.2 |
| Refseq ORF | 1170 |
| Synonyms | CAVIN; cavin-1; CGL4; FKSG13; PTRF |
| Summary | This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009] |
| Protein Families | Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Deficiency of cold-inducible RNA-binding protein exacerbated monocrotaline-induced pulmonary artery hypertension through Caveolin1 and CAVIN1
,Liu, J;Ke, X;Wang, L;Zhang, Y;Yang, J;,
Journal of cellular and molecular medicine
,PubMed ID 33755319
[CAVIN1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402171 | PTRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402171 | Transient overexpression lysate of polymerase I and transcript release factor (PTRF) |
CNY 3080.00 |
|
| PH309277 | PTRF MS Standard C13 and N15-labeled recombinant protein (NP_036364) |
CNY 19520.00 |
