NOTUM (NM_178493) Human Recombinant Protein
CAT#: TP309331
Recombinant protein of human notum pectinacetylesterase homolog (Drosophila) (NOTUM), 20 µg
View other "NOTUM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209331 protein sequence
Red=Cloning site Green=Tags(s) MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENC DSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGAL IIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRH TDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTV DNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDR SLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPS ELLGMLSNGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 29719227) |
Reference Data | |
RefSeq | NP_848588 |
Locus ID | 147111 |
UniProt ID | Q6P988 |
Refseq Size | 2281 |
Cytogenetics | 17q25.3 |
Refseq ORF | 1290 |
Synonyms | hNOTUM |
Summary | Carboxylesterase that acts as a key negative regulator of the Wnt signaling pathway by specifically mediating depalmitoleoylation of WNT proteins. Serine palmitoleoylation of WNT proteins is required for efficient binding to frizzled receptors (PubMed:25731175).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A Strategy for Discovery of Endocrine Interactions with Application to Whole-Body Metabolism
,Seldin, MM;Koplev, S;Rajbhandari, P;Vergnes, L;Rosenberg, GM;Meng, Y;Pan, C;Phuong, TMN;Gharakhanian, R;Che, N;Mäkinen, S;Shih, DM;Civelek, M;Parks, BW;Kim, ED;Norheim, F;Chella Krishnan, K;Hasin-Brumshtein, Y;Mehrabian, M;Laakso, M;Drevon, CA;Koistinen, HA;Tontonoz, P;Reue, K;Cantor, RM;Björkegren, JLM;Lusis, AJ;,
Cell Metab.
,PubMed ID 29719227
[NOTUM]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405887 | NOTUM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405887 | Transient overexpression lysate of notum pectinacetylesterase homolog (Drosophila) (NOTUM) |
CNY 3080.00 |
|
PH309331 | NOTUM MS Standard C13 and N15-labeled recombinant protein (NP_848588) |
CNY 19520.00 |