SCP3 (SYCP3) (NM_153694) Human Recombinant Protein
CAT#: TP309340
Recombinant protein of human synaptonemal complex protein 3 (SYCP3), 20 µg
View other "SCP3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209340 protein sequence
Red=Cloning site Green=Tags(s) MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM LQKKIMMETQQQEIASVRKSLQSMLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_710161 |
Locus ID | 50511 |
UniProt ID | Q8IZU3 |
Refseq Size | 1137 |
Cytogenetics | 12q23.2 |
Refseq ORF | 708 |
Synonyms | COR1; RPRGL4; SCP3; SPGF4 |
Summary | This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406978 | SYCP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432740 | SYCP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406978 | Transient overexpression lysate of synaptonemal complex protein 3 (SYCP3) |
CNY 3080.00 |
|
LY432740 | Transient overexpression lysate of synaptonemal complex protein 3 (SYCP3), transcript variant 1 |
CNY 3080.00 |
|
PH309340 | SYCP3 MS Standard C13 and N15-labeled recombinant protein (NP_710161) |
CNY 19520.00 |