XAGE3 (NM_130776) Human Recombinant Protein
CAT＃: TP309351
Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 2, 20 µg
View other "XAGE3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209351 protein sequence
Red=Cloning site Green=Tags(s) MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADL QELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_570132 |
| Locus ID | 170626 |
| UniProt ID | Q8WTP9 |
| Refseq Size | 493 |
| Cytogenetics | Xp11.22 |
| Refseq ORF | 333 |
| Synonyms | CT12.3a; CT12.3b; GAGED4; PLAC6; pp9012; XAGE-3 |
| Summary | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in inhibiting cancer cell growth. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene generates 2 transcript variants differing in the 5' UTR. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408847 | XAGE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408938 | XAGE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408847 | Transient overexpression lysate of X antigen family, member 3 (XAGE3), transcript variant 1 |
CNY 3080.00 |
|
| LY408938 | Transient overexpression lysate of X antigen family, member 3 (XAGE3), transcript variant 2 |
CNY 3080.00 |
|
| PH309351 | XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_570132) |
CNY 14250.00 |
|
| PH314210 | XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_573440) |
CNY 14250.00 |
|
| TP314210 | Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760910 | Purified recombinant protein of Human X antigen family, member 3 (XAGE3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
