LDHA (NM_005566) Human Recombinant Protein
CAT#: TP309378
Recombinant protein of human lactate dehydrogenase A (LDHA), transcript variant 1, 20 µg
View other "LDHA" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209378 representing NM_005566
Red=Cloning site Green=Tags(s) MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Higher specific activity than endogenous human LDHA: OriGene human recombinant LDHA (TP309378) was compared side-by-side with purified human liver LDH5 in a spectrophotometric pyruvate to lactate conversion assay. Activity is shown as a decrease in absorbance at 340nm over time. The activity of recombinant human LDHA is comparable to that of endogenously expressed human LDH5. |
| Reference Data | |
| RefSeq | NP_005557 |
| Locus ID | 3939 |
| UniProt ID | P00338 |
| Refseq Size | 1661 |
| Cytogenetics | 11p15.1 |
| Refseq ORF | 996 |
| Synonyms | GSD11; HEL-S-133P; LDHM; PIG19 |
| Summary | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401712 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427601 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431321 | LDHA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401712 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 1 |
CNY 3080.00 |
|
| LY427601 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 2 |
CNY 3080.00 |
|
| LY431321 | Transient overexpression lysate of lactate dehydrogenase A (LDHA), transcript variant 3 |
CNY 3080.00 |
|
| PH309378 | LDHA MS Standard C13 and N15-labeled recombinant protein (NP_005557) |
CNY 19520.00 |
|
| TP720209 | Recombinant protein of human lactate dehydrogenase A (LDHA), transcript variant 2 |
CNY 1800.00 |


