DGLUCY (NM_024952) Human Recombinant Protein
CAT#: TP309454
Recombinant protein of human chromosome 14 open reading frame 159 (C14orf159), transcript variant 3, 20 µg
View other "DGLUCY" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209454 protein sequence
Red=Cloning site Green=Tags(s) MPFTLHLRSRLPSAIRSLILQKKPNIRNTSSMAGELRPASLVVLPRSLAPAFERFCQVNTGPLPLLGQSE PEKWMLPPQGAISETRMGHPQFWKYEFGACTGSLASLEQYSEQLKDMVAFFLGCSFSLEEALEKAGLPRR DPAGHSQTTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKPAY GDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTDLKDAKAPPGCLTPERIPEVHHISQD PLHYSIASVSASQKIRELESMIGIDPGNRGIGHLLCKDELLKASLSLSHARSVLITTGFPTHFNHEPPEE TDGPPGAVALVAFLQALEKEVAIIVDQRAWNLHQKIVEDAVEQGVLKTQIPILTYQGGSVEAAQAFLCKN GDPQTPRFDHLVAIERAGRAADGNYYNARKMNIKHLVDPIDDLFLAAKKIPGISSTGVGDGGNELGMGKV KEAVRRHIRHGDVIACDVEADFAVIAGVSNWGGYALACALYILYSCAVHSQYLRKAVGPSRAPGDQAWTQ ALPSVIKEEKMLGILVQHKVRSGVSGIVGMEVDGLPFHNTHAEMIQKLVDVTTAQV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 66.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079228 |
| Locus ID | 80017 |
| UniProt ID | Q7Z3D6 |
| Refseq Size | 3011 |
| Cytogenetics | 14q32.11 |
| Refseq ORF | 1848 |
| Synonyms | C14orf159 |
| Summary | D-glutamate cyclase that converts D-glutamate to 5-oxo-D-proline.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410951 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420133 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420134 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420135 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420136 | C14orf159 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY410951 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 3 |
CNY 3080.00 |
|
| LY420133 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 1 |
CNY 4840.00 |
|
| LY420134 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 2 |
CNY 4840.00 |
|
| LY420135 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 4 |
CNY 4840.00 |
|
| LY420136 | Transient overexpression lysate of chromosome 14 open reading frame 159 (C14orf159), transcript variant 5 |
CNY 4840.00 |
|
| PH309454 | C14orf159 MS Standard C13 and N15-labeled recombinant protein (NP_079228) |
CNY 19520.00 |
