TCTN1 (NM_001082537) Human Recombinant Protein
CAT#: TP309467
Recombinant protein of human tectonic family member 1 (TCTN1), transcript variant 2, 20 µg
View other "TCTN1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209467 protein sequence
Red=Cloning site Green=Tags(s) MRPRGLPPLLVVLLGCWASVSAQTDATPAVTTEGLNSTEAALATFGTFPSTRPPGTPRAPGPSSGPRPTP VTDVAVLCVCDLSPAQCDINCCCDPDCSSVDFSVFSACSVPVVTGDSQFCSQKAVIYSLNFTANPPQRVF ELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYG VPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRK KVPITVQSIVIQSLNKTLTRREDTDVLQPTLVNAGHFSLCVNVVLEVKYSLTYTDAGEVTKADLSFVLGT VSSVVVPLQQKFEIHFLQENTQPVPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQD CLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHF ITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANSGNERTILISTAVTFVDV SAPAEAGFRAPPAINARLPFNFFFPFV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 63.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001076006 |
| Locus ID | 79600 |
| UniProt ID | Q2MV58 |
| Refseq Size | 2025 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 1761 |
| Synonyms | JBTS13; TECT1 |
| Summary | This gene encodes a member of a family of secreted and transmembrane proteins. The orthologous gene in mouse functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. This protein is a component of the tectonic-like complex, which forms a barrier between the ciliary axoneme and the basal body. A mutation in this gene was found in a family with Joubert syndrome-13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411247 | TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421188 | TCTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411247 | Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 3 |
CNY 3080.00 |
|
| LY421188 | Transient overexpression lysate of tectonic family member 1 (TCTN1), transcript variant 2 |
CNY 3080.00 |
|
| PH309467 | TCTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001076006) |
CNY 19520.00 |
