RGS20 (NM_003702) Human Recombinant Protein
CAT#: TP309495
Recombinant protein of human regulator of G-protein signaling 20 (RGS20), transcript variant 2, 20 µg
View other "RGS20" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209495 protein sequence
Red=Cloning site Green=Tags(s) MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCS CSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEE NMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIY TLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003693 |
Locus ID | 8601 |
UniProt ID | O76081 |
Refseq Size | 1716 |
Cytogenetics | 8q11.23 |
Refseq ORF | 723 |
Synonyms | g(z)GAP; gz-GAP; RGSZ1; ZGAP1 |
Summary | The protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406909 | RGS20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418490 | RGS20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406909 | Transient overexpression lysate of regulator of G-protein signaling 20 (RGS20), transcript variant 1 |
CNY 3080.00 |
|
LY418490 | Transient overexpression lysate of regulator of G-protein signaling 20 (RGS20), transcript variant 2 |
CNY 3080.00 |
|
PH309495 | RGS20 MS Standard C13 and N15-labeled recombinant protein (NP_003693) |
CNY 19520.00 |