COQ9 (NM_020312) Human Recombinant Protein
CAT#: TP309578
Recombinant protein of human coenzyme Q9 homolog (S. cerevisiae) (COQ9), 20 µg
View other "COQ9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209578 protein sequence
Red=Cloning site Green=Tags(s) MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEK PDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK DGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLP HNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDA MNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_064708 |
| Locus ID | 57017 |
| UniProt ID | O75208 |
| Refseq Size | 1699 |
| Cytogenetics | 16q21 |
| Refseq ORF | 954 |
| Synonyms | C16orf49; COQ10D5 |
| Summary | This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412553 | COQ9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412553 | Transient overexpression lysate of coenzyme Q9 homolog (S. cerevisiae) (COQ9) |
CNY 3080.00 |
|
| PH309578 | COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) |
CNY 19520.00 |
