GADD45GIP1 (NM_052850) Human Recombinant Protein
CAT#: TP309644
Recombinant protein of human growth arrest and DNA-damage-inducible, gamma interacting protein 1 (GADD45GIP1), 20 µg
View other "GADD45GIP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209644 protein sequence
Red=Cloning site Green=Tags(s) MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGV VPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQR ENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAV AQDPAASGAPSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443082 |
Locus ID | 90480 |
UniProt ID | Q8TAE8 |
Refseq Size | 772 |
Cytogenetics | 19p13.13 |
Refseq ORF | 666 |
Synonyms | CKBBP2; CKbetaBP2; CRIF1; MRP-L59; PLINP; PLINP-1; Plinp1; PRG6 |
Summary | This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409460 | GADD45GIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409460 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, gamma interacting protein 1 (GADD45GIP1) |
CNY 3080.00 |
|
PH309644 | GADD45GIP1 MS Standard C13 and N15-labeled recombinant protein (NP_443082) |
CNY 19520.00 |
其它GADD45GIP1产品