C5orf45 (MRNIP) (NM_016175) Human Recombinant Protein
CAT#: TP309653
Recombinant protein of human chromosome 5 open reading frame 45 (C5orf45), transcript variant 1, 20 µg
View other "C5orf45" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209653 protein sequence
Red=Cloning site Green=Tags(s) MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELP LRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGP RFSQDLPRKRKWSGSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRG PGKELWSPIQQVTATSSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPT AAVQLPRATHPVTSGSERPCGKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057259 |
Locus ID | 51149 |
UniProt ID | Q6NTE8 |
Refseq Size | 1229 |
Cytogenetics | 5q35.3 |
Refseq ORF | 1029 |
Synonyms | C5orf45 |
Summary | Plays a role in the cellular response to DNA damage and the maintenance of genome stability through its association with the MRN damage-sensing complex (PubMed:27568553). Promotes chromatin loading and activity of the MRN complex to facilitate subsequent ATM-mediated DNA damage response signaling and DNA repair (PubMed:27568553).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414145 | C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422227 | C5orf45 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414145 | Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 1 |
CNY 3080.00 |
|
LY422227 | Transient overexpression lysate of chromosome 5 open reading frame 45 (C5orf45), transcript variant 2 |
CNY 3080.00 |
|
PH309653 | C5orf45 MS Standard C13 and N15-labeled recombinant protein (NP_057259) |
CNY 19520.00 |
其它C5orf45产品