p21 ARC (ARPC3) (NM_005719) Human Recombinant Protein
CAT#: TP309711L
Recombinant protein of human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209711 protein sequence
Red=Cloning site Green=Tags(s) MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIY ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQET GLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005710 |
| Locus ID | 10094 |
| UniProt ID | O15145 |
| Refseq Size | 962 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 534 |
| Synonyms | ARC21; p21-Arc |
| Summary | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013] |
| Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
其它p21 ARC产品
