C10orf97 (FAM188A) (NM_024948) Human Recombinant Protein
CAT#: TP309783
Recombinant protein of human chromosome 10 open reading frame 97 (C10orf97), 20 µg
View other "C10orf97" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209783 protein sequence
Red=Cloning site Green=Tags(s) MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP IKRCLQTKWPYIELLWTTDRSPSLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079224 |
| Locus ID | 80013 |
| UniProt ID | Q9H8M7 |
| Refseq Size | 2375 |
| Cytogenetics | 10p13 |
| Refseq ORF | 1335 |
| Synonyms | C10orf97; CARP; DERP5; FAM188A; MST126; MSTP126; my042 |
| Summary | The protein encoded by this gene contains a caspase-associated recruitment domain and may function in apoptosis. It has been identified as a tumor suppressor in lung and gastric cancers, and a polymorphism in the gene may be associated with gastric cancer risk. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410949 | FAM188A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410949 | Transient overexpression lysate of family with sequence similarity 188, member A (FAM188A) |
CNY 3080.00 |
|
| PH309783 | FAM188A MS Standard C13 and N15-labeled recombinant protein (NP_079224) |
CNY 19520.00 |
其它C10orf97产品
