C13orf15 (RGCC) (NM_014059) Human Recombinant Protein
CAT#: TP309810
Recombinant protein of human chromosome 13 open reading frame 15 (C13orf15), 20 µg
View other "C13orf15" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209810 protein sequence
Red=Cloning site Green=Tags(s) MKQPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054778 |
Locus ID | 28984 |
UniProt ID | Q9H4X1 |
Refseq Size | 1126 |
Cytogenetics | 13q14.11 |
Refseq ORF | 411 |
Synonyms | bA157L14.2; C13orf15; RGC-32; RGC32 |
Summary | This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415502 | RGCC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415502 | Transient overexpression lysate of chromosome 13 open reading frame 15 (C13orf15) |
CNY 3080.00 |
|
PH309810 | C13orf15 MS Standard C13 and N15-labeled recombinant protein (NP_054778) |
CNY 19520.00 |
其它C13orf15产品