Ferritin Heavy Chain (FTH1) (NM_002032) Human Recombinant Protein
CAT#: TP309845
Recombinant protein of human ferritin, heavy polypeptide 1 (FTH1), 20 µg
View other "Ferritin Heavy Chain" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209845 protein sequence
Red=Cloning site Green=Tags(s) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002023 |
| Locus ID | 2495 |
| UniProt ID | P02794 |
| Refseq Size | 1245 |
| Cytogenetics | 11q12.3 |
| Refseq ORF | 549 |
| Synonyms | FHC; FTH; FTHL6; HFE5; PIG15; PLIF |
| Summary | This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Porphyrin and chlorophyll metabolism |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Simple plant-based production and purification of the assembled human ferritin heavy chain as a nanocarrier for tumor-targeted drug delivery and bioimaging in cancer therapy.
,null,
Biotechnology and bioengineering
,PubMed ID 36539373
[FTH1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400741 | FTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400741 | Transient overexpression lysate of ferritin, heavy polypeptide 1 (FTH1) |
CNY 3080.00 |
|
| PH309845 | FTH1 MS Standard C13 and N15-labeled recombinant protein (NP_002023) |
CNY 19520.00 |
|
| TP721180 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 3140.00 |
|
| TP721183 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
CNY 1800.00 |
其它Ferritin Heavy Chain产品
