LMOD1 (NM_012134) Human Recombinant Protein
CAT#: TP309941
Recombinant protein of human leiomodin 1 (smooth muscle) (LMOD1), 20 µg
View other "LMOD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209941 representing NM_012134
Red=Cloning site Green=Tags(s) MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 66.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA capture for autoantibodies (PMID: 28202777) |
| Reference Data | |
| RefSeq | NP_036266 |
| Locus ID | 25802 |
| UniProt ID | P29536 |
| Refseq Size | 3967 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 1800 |
| Synonyms | 1D; 64kD; D1; MMIHS3; SM-LMOD; SMLMOD |
| Summary | The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy. [provided by RefSeq, Jul 2008] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Nodding syndrome may be an autoimmune reaction to the parasitic worm Onchocerca volvulus
,Johnson, TP;Tyagi, R;Lee, PR;Lee, MH;Johnson, KR;Kowalak, J;Elkahloun, A;Medynets, M;Hategan, A;Kubofcik, J;Sejvar, J;Ratto, J;Bunga, S;Makumbi, I;Aceng, JR;Nutman, TB;Dowell, SF;Nath, A;,
Sci Transl Med
,PubMed ID 28202777
[LMOD1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415960 | LMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415960 | Transient overexpression lysate of leiomodin 1 (smooth muscle) (LMOD1) |
CNY 3080.00 |
|
| PH309941 | LMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_036266) |
CNY 19520.00 |

