SPARC (NM_003118) Human Recombinant Protein
CAT#: TP309964
Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC), 20 µg
View other "SPARC" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209964 protein sequence
Red=Cloning site Green=Tags(s) MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY IALDEWAGCFGIKQKDIDKDLVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003109 |
| Locus ID | 6678 |
| UniProt ID | P09486 |
| Refseq Size | 3604 |
| Cytogenetics | 5q33.1 |
| Refseq ORF | 909 |
| Synonyms | BM-40; OI17; ON; ONT |
| Summary | This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418873 | SPARC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418873 | Transient overexpression lysate of secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
CNY 3080.00 |
|
| PH309964 | SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) |
CNY 19520.00 |
|
| TP720332 | Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
CNY 3140.00 |
