HGD (NM_000187) Human Recombinant Protein
CAT#: TP310009
Recombinant protein of human homogentisate 1,2-dioxygenase (homogentisate oxidase) (HGD), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210009 protein sequence
Red=Cloning site Green=Tags(s) MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSH KPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNT SMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFEL PDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLK NFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD ENYHKCWEPLKSHFTPNSRNPAEPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000178 |
| Locus ID | 3081 |
| UniProt ID | Q93099 |
| Refseq Size | 2012 |
| Cytogenetics | 3q13.33 |
| Refseq ORF | 1335 |
| Synonyms | AKU; HGO |
| Summary | This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.[provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424883 | HGD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424883 | Transient overexpression lysate of homogentisate 1,2-dioxygenase (homogentisate oxidase) (HGD) |
CNY 3080.00 |
|
| PH310009 | HGD MS Standard C13 and N15-labeled recombinant protein (NP_000178) |
CNY 19520.00 |
