TYW3 (NM_138467) Human Recombinant Protein
CAT#: TP310021
Recombinant protein of human tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), 20 µg
View other "TYW3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210021 protein sequence
Red=Cloning site Green=Tags(s) MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT MLVVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612476 |
| Locus ID | 127253 |
| UniProt ID | Q6IPR3 |
| Refseq Size | 3448 |
| Cytogenetics | 1p31.1 |
| Refseq ORF | 777 |
| Synonyms | C1orf171 |
| Summary | Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408593 | TYW3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431186 | TYW3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408593 | Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 1 |
CNY 3080.00 |
|
| LY431186 | Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 2 |
CNY 3080.00 |
|
| PH310021 | TYW3 MS Standard C13 and N15-labeled recombinant protein (NP_612476) |
CNY 19520.00 |
