TYW3 (NM_138467) Human Recombinant Protein
CAT#: TP310021
Recombinant protein of human tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), 20 µg
View other "TYW3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210021 protein sequence
Red=Cloning site Green=Tags(s) MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNC CWLLVTHKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKT MLVVRSTHGLEVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKE KNNSSYIHKKKRNPEKTRAQCITKESDEELENDDDDDLGINVTIFPEDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612476 |
Locus ID | 127253 |
UniProt ID | Q6IPR3 |
Refseq Size | 3448 |
Cytogenetics | 1p31.1 |
Refseq ORF | 777 |
Synonyms | C1orf171 |
Summary | Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW synthesis (Noma and Suzuki, 2006).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408593 | TYW3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431186 | TYW3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408593 | Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 1 |
CNY 3080.00 |
|
LY431186 | Transient overexpression lysate of tRNA-yW synthesizing protein 3 homolog (S. cerevisiae) (TYW3), transcript variant 2 |
CNY 3080.00 |
|
PH310021 | TYW3 MS Standard C13 and N15-labeled recombinant protein (NP_612476) |
CNY 19520.00 |