PDLIM2 (NM_021630) Human Recombinant Protein
CAT＃: TP310022
Recombinant protein of human PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2, 20 µg
View other "PDLIM2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210022 protein sequence
Red=Cloning site Green=Tags(s) MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS RA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067643 |
| Locus ID | 64236 |
| UniProt ID | Q96JY6 |
| Refseq Size | 2246 |
| Cytogenetics | 8p21.3 |
| Refseq ORF | 1056 |
| Synonyms | MYSTIQUE; SLIM |
| Summary | This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406049 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411957 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430460 | PDLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406049 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 |
CNY 3080.00 |
|
| LY411957 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 2 |
CNY 3080.00 |
|
| LY430460 | Transient overexpression lysate of PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1 |
CNY 3080.00 |
|
| PH310022 | PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_067643) |
CNY 19520.00 |
|
| PH319644 | PDLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_789847) |
CNY 14250.00 |
|
| TP319644 | Purified recombinant protein of Homo sapiens PDZ and LIM domain 2 (mystique) (PDLIM2), transcript variant 1, 20 µg |
CNY 2900.00 |
PDLIM2 mouse monoclonal antibody, clone OTI10C4 (formerly 10C4)
