MOX1 (MEOX1) (NM_004527) Human Recombinant Protein
CAT#: TP310106
Recombinant protein of human mesenchyme homeobox 1 (MEOX1), transcript variant 1, 20 µg
View other "MOX1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210106 protein sequence
Red=Cloning site Green=Tags(s) MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004518 |
| Locus ID | 4222 |
| UniProt ID | P50221 |
| Refseq Size | 2330 |
| Cytogenetics | 17q21.31 |
| Refseq ORF | 762 |
| Synonyms | KFS2; MOX1 |
| Summary | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417902 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421872 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417902 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 1 |
CNY 3080.00 |
|
| LY421872 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 3 |
CNY 3080.00 |
|
| PH310106 | MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518) |
CNY 19520.00 |
