KLRA1 (KLRA1P) (NM_006611) Human Recombinant Protein
CAT#: TP310234
Recombinant protein of human killer cell lectin-like receptor subfamily A, member 1 (KLRA1), 20 µg
View other "KLRA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210234 protein sequence
Red=Cloning site Green=Tags(s) MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIF QCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIV FKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSM LDLRY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006602 |
Locus ID | 10748 |
Refseq Size | 2208 |
Cytogenetics | 12p13.2 |
Refseq ORF | 645 |
Synonyms | A1; class I MHC receptor KLRA22; killer cell lectin-like receptor, subfamily A, member 1; KLRA#; Klra22; Ly-49L; Ly49; Ly49a; LY49L; Ly49o; Ly49v; MGC126520; MGC126522; natural killer cell receptor Ly49A; OTTMUSP00000026268 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416527 | KLRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416527 | Transient overexpression lysate of killer cell lectin-like receptor subfamily A, member 1 (KLRA1) |
CNY 3080.00 |
|
PH310234 | KLRA1 MS Standard C13 and N15-labeled recombinant protein (NP_006602) |
CNY 19520.00 |