PRRX1 (NM_022716) Human Recombinant Protein
CAT＃: TP310393
Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1b, 20 µg
View other "PRRX1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210393 protein sequence
Red=Cloning site Green=Tags(s) MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYSAMATYSATCA NNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_073207 |
| Locus ID | 5396 |
| UniProt ID | P54821 |
| Refseq Size | 3999 |
| Cytogenetics | 1q24.2 |
| Refseq ORF | 735 |
| Synonyms | AGOTC; PHOX1; PMX1; PRX-1; PRX1 |
| Summary | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411607 | PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416343 | PRRX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411607 | Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1b |
CNY 3080.00 |
|
| LY416343 | Transient overexpression lysate of paired related homeobox 1 (PRRX1), transcript variant pmx-1a |
CNY 3080.00 |
|
| PH310393 | PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_073207) |
CNY 19520.00 |
|
| PH313276 | PRRX1 MS Standard C13 and N15-labeled recombinant protein (NP_008833) |
CNY 19520.00 |
|
| TP313276 | Recombinant protein of human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, 20 µg |
CNY 2900.00 |
PRRX1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
