CACNB4 (NM_000726) Human Recombinant Protein
CAT#: TP310440
Recombinant protein of human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 20 µg
View other "CACNB4" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210440 protein sequence
Red=Cloning site Green=Tags(s) MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDR EAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGR LVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHI PPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAII ERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRG KSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEE DYPDSYQDTYKPHRNRGSPGGYSHDSRHRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000717 |
Locus ID | 785 |
UniProt ID | O00305 |
Refseq Size | 7979 |
Cytogenetics | 2q23.3 |
Refseq ORF | 1560 |
Synonyms | CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6 |
Summary | This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE), juvenile myoclonic epilepsy (JME), and episodic ataxia, type 5. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400240 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423646 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423647 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC429012 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400240 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2 |
CNY 3080.00 |
|
LY423646 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3 |
CNY 4840.00 |
|
LY423647 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1 |
CNY 4840.00 |
|
LY429012 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4 |
CNY 3080.00 |
|
PH310440 | CACNB4 MS Standard C13 and N15-labeled recombinant protein (NP_000717) |
CNY 19520.00 |