SPTSSB (NM_001040100) Human Recombinant Protein
CAT#: TP310453
Recombinant protein of human chromosome 3 open reading frame 57 (C3orf57), 20 µg
View other "SPTSSB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210453 protein sequence
Red=Cloning site Green=Tags(s) MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGY HSTISN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035189 |
| Locus ID | 165679 |
| UniProt ID | Q8NFR3 |
| Refseq Size | 2306 |
| Cytogenetics | 3q26.1 |
| Refseq ORF | 228 |
| Synonyms | ADMP; C3orf57; SSSPTB |
| Summary | Serine palmitoyltransferase (SPT; EC 2.3.1.50) catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. SSSPTB is a small SPT subunit that stimulates SPT activity and confers acyl-CoA preference to the SPT catalytic heterodimer of SPTLC1 (MIM 605712) and either SPTLC2 (MIM 605713) or SPTLC3 (MIM 611120) (Han et al., 2009 [PubMed 19416851]).[supplied by OMIM, Nov 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421673 | SPTSSB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421673 | Transient overexpression lysate of chromosome 3 open reading frame 57 (C3orf57) |
CNY 3080.00 |
|
| PH310453 | C3orf57 MS Standard C13 and N15-labeled recombinant protein (NP_001035189) |
CNY 19520.00 |
